PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G08680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 433aa    MW: 45365.1 Da    PI: 5.9112
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G08680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like889e-28211265156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH+rFv+aveqL G++kA+P++ilelm++++Lt+++++SHLQkYR++
  OPUNC01G08680.1 211 KVKVDWTPELHRRFVQAVEQL-GIDKAVPSRILELMGIECLTRHNIASHLQKYRSH 265
                      5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.104208267IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-26209268IPR009057Homeodomain-like
SuperFamilySSF466894.48E-18209268IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26211265IPR006447Myb domain, plants
PfamPF002491.8E-7214263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MLEVSTLRSP KADQRAGVGG HHVVGFVPAP SSADVVDEVD AFIVDDSLLE YIDFSCCDVP  60
FFHADDGDIL PDLEVDPTEL LAEFASSPDE EPQQTSAASP GEAAAASGAK EDVKQGETTA  120
ADYDGSPSPP PGKKKDNEER SSSLLEEKDG KNGGATDEVL SAVTTEDSSA AAGCDGAAKS  180
SSPSAEGHSK RKPSSSSSSA AAGKNSHGKR KVKVDWTPEL HRRFVQAVEQ LGIDKAVPSR  240
ILELMGIECL TRHNIASHLQ KYRSHRKHLM AREAEAASWT QKRQMYTAAA AVAAGGGPRK  300
DAAATAAVAP WAARKWGPQA VTPGTPCMPP PLPPAAMLQR FPVPPVPGMV PHPMYRPIPP  360
PLPPQGNKLA ALQLQLDAHP SKESIDAAIG DVLVKTWLPL PLGLKPPSLD SVMSELHKQG  420
IPKVPPAASG GAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15208263257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8340420.0CT834042.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA220E01, full insert sequence.
GenBankCT8340440.0CT834044.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI210C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615905.11e-145PREDICTED: probable transcription factor GLK2 isoform X1
SwissprotQ5NAN51e-147GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLA0A0E0JG610.0A0A0E0JG61_ORYPU; Uncharacterized protein
STRINGORGLA01G0079000.11e-178(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-45GBF's pro-rich region-interacting factor 1